Lineage for d1n2mf_ (1n2m F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679286Fold d.155: Pyruvoyl-dependent histidine and arginine decarboxylases [56270] (1 superfamily)
    duplication of beta-alpha-beta(2) motif; 4 layers: alpha/beta/beta/alpha; contains "silk" beta-sandwich
  4. 1679287Superfamily d.155.1: Pyruvoyl-dependent histidine and arginine decarboxylases [56271] (2 families) (S)
    two chains result from self-processing single-chain precursor; form heterohexamer
  5. 1679308Family d.155.1.2: Arginine decarboxylase [90046] (2 proteins)
  6. 1679309Protein Arginine decarboxylase [90047] (1 species)
  7. 1679310Species Methanococcus jannaschii [TaxId:2190] [90048] (3 PDB entries)
  8. 1679328Domain d1n2mf_: 1n2m F: [85283]
    the proenzyme S53A mutant
    complexed with mrd

Details for d1n2mf_

PDB Entry: 1n2m (more details), 1.9 Å

PDB Description: the s53a proenzyme structure of methanococcus jannaschii.
PDB Compounds: (F:) Pyruvoyl-dependent arginine decarboxylase

SCOPe Domain Sequences for d1n2mf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2mf_ d.155.1.2 (F:) Arginine decarboxylase {Methanococcus jannaschii [TaxId: 2190]}
klpntvslvagssegetplnafdgallnagignvnlirisaimppeaeivplpklpmgal
vptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaektvremakigfe
mrgweldriesiavehtveklgcafaaaalwyk

SCOPe Domain Coordinates for d1n2mf_:

Click to download the PDB-style file with coordinates for d1n2mf_.
(The format of our PDB-style files is described here.)

Timeline for d1n2mf_: