SCOPe 2.06: Domain d1n2ib_: 1n2i B:

Lineage for d1n2ib_ (1n2i B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
   contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
   automatically mapped to Pfam PF02569

6. Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [89615] (48 PDB entries)

8. Domain d1n2ib_: 1n2i B: [85275]
   structural genomics
   complexed with eoh, gol, paj, so4

Details for d1n2ib_

PDB Entry: 1n2i, 1.7 Å

PDB Description: crystal structure of pantothenate synthetase from m. tuberculosis in complex with a reaction intermediate, pantoyl adenylate, different occupancies of pantoyl adenylate

PDB Compounds: (B:) Pantothenate synthetase

SCOPe Domain Sequences for d1n2ib_:

Sequence; same for both SEQRES and ATOM records:

>d1n2ib_ c.26.1.4 (B:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]}
aipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsv
vvvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpg
plaaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvav
vgvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravlda
apgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieig

Timeline for d1n2ib_:

• d1n2ib_ first appeared in SCOP 1.65
  
• d1n2ib_ appears in SCOPe 2.05
  
• d1n2ib_ appears in SCOPe 2.07
  
• d1n2ib_ appears in the current release, SCOPe 2.08