Lineage for d1n25b_ (1n25 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394970Family c.37.1.20: Extended AAA-ATPase domain [81269] (18 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 395127Protein Papillomavirus large T antigen helicase domain [89688] (1 species)
  7. 395128Species Simian virus 40 [TaxId:10633] [89689] (1 PDB entry)
  8. 395130Domain d1n25b_: 1n25 B: [85265]
    complexed with zn

Details for d1n25b_

PDB Entry: 1n25 (more details), 2.8 Å

PDB Description: Crystal structure of the SV40 Large T antigen helicase domain

SCOP Domain Sequences for d1n25b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n25b_ c.37.1.20 (B:) Papillomavirus large T antigen helicase domain {Simian virus 40}
kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
ld

SCOP Domain Coordinates for d1n25b_:

Click to download the PDB-style file with coordinates for d1n25b_.
(The format of our PDB-style files is described here.)

Timeline for d1n25b_: