SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1n25b_ (1n25 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113456Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 protein domains)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2113679Protein Papillomavirus large T antigen helicase domain [89688] (1 species)
  7. 2113680Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries)
    Uniprot P03070 265-627
  8. 2113693Domain d1n25b_: 1n25 B: [85265]
    complexed with zn

Details for d1n25b_

PDB Entry: 1n25 (more details), 2.8 Å

PDB Description: Crystal structure of the SV40 Large T antigen helicase domain
PDB Compounds: (B:) large t antigen

SCOPe Domain Sequences for d1n25b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n25b_ c.37.1.20 (B:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}
kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
ld

SCOPe Domain Coordinates for d1n25b_:

Click to download the PDB-style file with coordinates for d1n25b_.
(The format of our PDB-style files is described here.)

Timeline for d1n25b_: