Class g: Small proteins [56992] (98 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain |
Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins) |
Protein Znf265, first zinc-finger domain [90211] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [90212] (1 PDB entry) |
Domain d1n0za1: 1n0z A:3-42 [85247] Other proteins in same PDB: d1n0za2, d1n0za3 complexed with zn |
PDB Entry: 1n0z (more details)
SCOPe Domain Sequences for d1n0za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0za1 g.41.11.1 (A:3-42) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} mstknfrvsdgdwicpdkkcgnvnfarrtscdrcgrektt
Timeline for d1n0za1: