Lineage for d1n0za1 (1n0z A:3-42)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2642018Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) (S)
    contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain
  5. 2642019Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins)
  6. 2642048Protein Znf265, first zinc-finger domain [90211] (1 species)
  7. 2642049Species Human (Homo sapiens) [TaxId:9606] [90212] (1 PDB entry)
  8. 2642050Domain d1n0za1: 1n0z A:3-42 [85247]
    Other proteins in same PDB: d1n0za2, d1n0za3
    complexed with zn

Details for d1n0za1

PDB Entry: 1n0z (more details)

PDB Description: solution structure of the first zinc-finger domain from znf265
PDB Compounds: (A:) znf265

SCOPe Domain Sequences for d1n0za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0za1 g.41.11.1 (A:3-42) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]}
mstknfrvsdgdwicpdkkcgnvnfarrtscdrcgrektt

SCOPe Domain Coordinates for d1n0za1:

Click to download the PDB-style file with coordinates for d1n0za1.
(The format of our PDB-style files is described here.)

Timeline for d1n0za1: