Lineage for d1my6b2 (1my6 B:89-198)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189807Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2189808Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2189809Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2189837Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 2189932Species Thermosynechococcus elongatus [TaxId:146786] [89910] (1 PDB entry)
  8. 2189934Domain d1my6b2: 1my6 B:89-198 [85235]
    Other proteins in same PDB: d1my6a1, d1my6b1
    complexed with fe

Details for d1my6b2

PDB Entry: 1my6 (more details), 1.6 Å

PDB Description: The 1.6 A Structure of Fe-Superoxide Dismutase from the thermophilic cyanobacterium Thermosynechococcus elongatus : Correlation of EPR and Structural Characteristics
PDB Compounds: (B:) Iron (III) Superoxide Dismutase

SCOPe Domain Sequences for d1my6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1my6b2 d.44.1.1 (B:89-198) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]}
ggggvptgdvaarinsafgsydefkaqfknaaatqfgsgwawlvleagtlkvtktanaen
plvhgqvplltidvwehayyldyqnrrpdfidnflnqlvnwdfvaknlaa

SCOPe Domain Coordinates for d1my6b2:

Click to download the PDB-style file with coordinates for d1my6b2.
(The format of our PDB-style files is described here.)

Timeline for d1my6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1my6b1