Lineage for d1mxob_ (1mxo B:)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 617469Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 617470Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 617471Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (13 proteins)
  6. 617472Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 617490Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (32 PDB entries)
  8. 617516Domain d1mxob_: 1mxo B: [85196]
    complexed with po4, sm2

Details for d1mxob_

PDB Entry: 1mxo (more details), 1.83 Å

PDB Description: AmpC beta-lactamase in complex with an m.carboxyphenylglycylboronic acid bearing the cephalothin R1 side chain

SCOP Domain Sequences for d1mxob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxob_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOP Domain Coordinates for d1mxob_:

Click to download the PDB-style file with coordinates for d1mxob_.
(The format of our PDB-style files is described here.)

Timeline for d1mxob_: