| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein Galactose-specific C-type lectin [90061] (1 species) |
| Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [90062] (2 PDB entries) |
| Domain d1muqd_: 1muq D: [85114] complexed with ca, gal, na, tdg |
PDB Entry: 1muq (more details), 2.3 Å
SCOPe Domain Sequences for d1muqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1muqd_ d.169.1.1 (D:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]}
ncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyhk
gqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwndq
vceskdaflcqckf
Timeline for d1muqd_:
View in 3DDomains from other chains: (mouse over for more information) d1muqa_, d1muqb_, d1muqc_, d1muqe_ |