SCOP 1.67: Domain d1mtca1: 1mtc A:85-217

Lineage for d1mtca1 (1mtc A:85-217)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)

8. Domain d1mtca1: 1mtc A:85-217 [85103]
   Other proteins in same PDB: d1mtca2, d1mtcb2

Details for d1mtca1

PDB Entry: 1mtc, 2.2 Å

PDB Description: glutathione transferase mutant y115f

SCOP Domain Sequences for d1mtca1:

Sequence; same for both SEQRES and ATOM records:

>d1mtca1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus)}
lcgeteeeriradivenqvmdnrmqlimlcfnpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

Timeline for d1mtca1:

• d1mtca1 first appeared in SCOP 1.65
  
• d1mtca1 appears in SCOP 1.69
  
• d1mtca1 appears in the current release, SCOPe 2.08