Lineage for d1mpua_ (1mpu A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226319Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1226320Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1226321Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1226548Protein NK cell-activating receptor nkg2d [64453] (2 species)
  7. 1226549Species Human (Homo sapiens) [TaxId:9606] [64455] (3 PDB entries)
  8. 1226554Domain d1mpua_: 1mpu A: [85040]
    complexed with po4

Details for d1mpua_

PDB Entry: 1mpu (more details), 2.5 Å

PDB Description: crystal structure of the free human nkg2d immunoreceptor
PDB Compounds: (A:) nkg2-d type II integral membrane protein

SCOPe Domain Sequences for d1mpua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpua_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Human (Homo sapiens) [TaxId: 9606]}
qipltesycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllk
lvksyhwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpn
tyicmqrt

SCOPe Domain Coordinates for d1mpua_:

Click to download the PDB-style file with coordinates for d1mpua_.
(The format of our PDB-style files is described here.)

Timeline for d1mpua_: