Lineage for d1moeb1 (1moe B:1-119)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1104358Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1104792Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (30 PDB entries)
  8. 1104808Domain d1moeb1: 1moe B:1-119 [85032]
    Other proteins in same PDB: d1moea2, d1moeb2
    part of anti-CEA scFv T84.66; VL to VH linkage: includes linker residues 112-119; assembles as a diabody
    complexed with so4

Details for d1moeb1

PDB Entry: 1moe (more details), 2.6 Å

PDB Description: the three-dimensional structure of an engineered scfv t84.66 dimer or diabody in vl to vh linkage.
PDB Compounds: (B:) anti-CEA mAb T84.66

SCOPe Domain Sequences for d1moeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1moeb1 b.1.1.1 (B:1-119) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqratmscragesvdifgvgflhwyqqkpgqppklliyrasnles
gipvrfsgtgsrtdftliidpveaddvatyycqqtnedpytfgggtkleikgggsgggg

SCOPe Domain Coordinates for d1moeb1:

Click to download the PDB-style file with coordinates for d1moeb1.
(The format of our PDB-style files is described here.)

Timeline for d1moeb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1moeb2