Lineage for d1ml6b1 (1ml6 B:380-521)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1491614Protein Class alpha GST [81349] (8 species)
  7. 1491730Species Mouse (Mus musculus), (a2-2) [TaxId:10090] [89059] (1 PDB entry)
  8. 1491732Domain d1ml6b1: 1ml6 B:380-521 [85011]
    Other proteins in same PDB: d1ml6a2, d1ml6b2
    complexed with gbx, ipa

Details for d1ml6b1

PDB Entry: 1ml6 (more details), 1.9 Å

PDB Description: Crystal Structure of mGSTA2-2 in Complex with the Glutathione Conjugate of Benzo[a]pyrene-7(R),8(S)-Diol-9(S),10(R)-Epoxide
PDB Compounds: (B:) Glutathione S-Transferase GT41A

SCOPe Domain Sequences for d1ml6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml6b1 a.45.1.1 (B:380-521) Class alpha GST {Mouse (Mus musculus), (a2-2) [TaxId: 10090]}
lygkdmkeralidmytegildltemigqlvlcppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdvhllelllyveeldaslltpfpllkafksrisslpnvkkflqp
gsqrkppldakqieearkvfkf

SCOPe Domain Coordinates for d1ml6b1:

Click to download the PDB-style file with coordinates for d1ml6b1.
(The format of our PDB-style files is described here.)

Timeline for d1ml6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ml6b2