Lineage for d1mkzb_ (1mkz B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 838437Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 838438Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 838439Family c.57.1.1: MogA-like [53219] (5 proteins)
  6. 838447Protein MoaB [89722] (2 species)
  7. 838452Species Escherichia coli [TaxId:562] [89723] (2 PDB entries)
    Uniprot P30746
  8. 838454Domain d1mkzb_: 1mkz B: [84999]
    complexed with acy, mse, so4

Details for d1mkzb_

PDB Entry: 1mkz (more details), 1.6 Å

PDB Description: crystal structure of moab protein at 1.6 a resolution.
PDB Compounds: (B:) Molybdenum cofactor biosynthesis protein B

SCOP Domain Sequences for d1mkzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkzb_ c.57.1.1 (B:) MoaB {Escherichia coli [TaxId: 562]}
sqvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaqv
sawiasddvqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlqs
ravagvanktlilampgstkacrtaweniiapqldartrpcnfhphlkkgs

SCOP Domain Coordinates for d1mkzb_:

Click to download the PDB-style file with coordinates for d1mkzb_.
(The format of our PDB-style files is described here.)

Timeline for d1mkzb_: