SCOP 1.65: Domain d1mkzb_: 1mkz B:

Lineage for d1mkzb_ (1mkz B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families)

5. Family c.57.1.1: MogA-like [53219] (4 proteins)

6. Protein MoaB [89722] (1 species)

7. Species Escherichia coli [TaxId:562] [89723] (1 PDB entry)

8. Domain d1mkzb_: 1mkz B: [84999]
   complexed with acy, mse, so4

Details for d1mkzb_

PDB Entry: 1mkz, 1.6 Å

PDB Description: crystal structure of moab protein at 1.6 a resolution.

SCOP Domain Sequences for d1mkzb_:

Sequence; same for both SEQRES and ATOM records:

>d1mkzb_ c.57.1.1 (B:) MoaB {Escherichia coli}
sqvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaqv
sawiasddvqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlqs
ravagvanktlilampgstkacrtaweniiapqldartrpcnfhphlkkgs

Timeline for d1mkzb_:

• d1mkzb_ is new in SCOP 1.65
  
• d1mkzb_ appears in SCOP 1.67
  
• d1mkzb_ appears in the current release, SCOPe 2.08, called d1mkzb1