Lineage for d1mkdg_ (1mkd G:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1101761Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1101762Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1101839Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1101881Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 1101882Species Human (Homo sapiens) [TaxId:9606] [89152] (22 PDB entries)
    Uniprot Q08499 388-713
  8. 1101941Domain d1mkdg_: 1mkd G: [84988]
    complexed with mg, zar, zn

Details for d1mkdg_

PDB Entry: 1mkd (more details), 2.9 Å

PDB Description: crystal structure of PDE4D catalytic domain and zardaverine complex
PDB Compounds: (G:) Phosphodiesterase 4D

SCOPe Domain Sequences for d1mkdg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkdg_ a.211.1.2 (G:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffpqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipqs

SCOPe Domain Coordinates for d1mkdg_:

Click to download the PDB-style file with coordinates for d1mkdg_.
(The format of our PDB-style files is described here.)

Timeline for d1mkdg_: