SCOPe 2.04: Domain d1mk4b_: 1mk4 B:

Lineage for d1mk4b_ (1mk4 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Hypothetical protein YqiY [90013] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [90014] (1 PDB entry)

8. Domain d1mk4b_: 1mk4 B: [84980]
   structural genomics

Details for d1mk4b_

PDB Entry: 1mk4, 1.7 Å

PDB Description: structure of protein of unknown function yqjy from bacillus subtilis, probable acetyltransferase

PDB Compounds: (B:) Hypothetical protein yqjY

SCOPe Domain Sequences for d1mk4b_:

Sequence; same for both SEQRES and ATOM records:

>d1mk4b_ d.108.1.1 (B:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]}
hmdirtitssdyemvtsvlnewwggrqlkeklprlffehfqdtsfitsehnsmtgfligf
qsqsdpetayihfsgvhpdfrkmqigkqlydvfietvkqrgctrvkcvtspvnkvsiayh
tklgfdiekgtktvngisvfanydgpgqdrvlfvkni

Timeline for d1mk4b_:

• d1mk4b_ first appeared in SCOP 1.65
  
• d1mk4b_ appears in SCOPe 2.03
  
• d1mk4b_ appears in SCOPe 2.05
  
• d1mk4b_ appears in the current release, SCOPe 2.08, called d1mk4b1