Lineage for d1mb8a2 (1mb8 A:181-293)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538206Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 538207Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family) (S)
  5. 538208Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (9 proteins)
    Pfam 00307
  6. 538209Protein Actin binding domain of plectin [89056] (1 species)
    duplication: consists of tandem repeat of two CH domains
  7. 538210Species Human (Homo sapiens) [TaxId:9606] [89057] (3 PDB entries)
  8. 538218Domain d1mb8a2: 1mb8 A:181-293 [84926]

Details for d1mb8a2

PDB Entry: 1mb8 (more details), 2.15 Å

PDB Description: Crystal Structure of the actin binding domain of plectin

SCOP Domain Sequences for d1mb8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mb8a2 a.40.1.1 (A:181-293) Actin binding domain of plectin {Human (Homo sapiens)}
qsedmtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpllidmnkvyrq
tnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamprvp

SCOP Domain Coordinates for d1mb8a2:

Click to download the PDB-style file with coordinates for d1mb8a2.
(The format of our PDB-style files is described here.)

Timeline for d1mb8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mb8a1