SCOP 1.71: Domain d1mb8a2: 1mb8 A:181-293

Lineage for d1mb8a2 (1mb8 A:181-293)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (9 proteins)
   Pfam 00307

6. Protein Actin binding domain of plectin [89056] (1 species)
   duplication: consists of tandem repeat of two CH domains

7. Species Human (Homo sapiens) [TaxId:9606] [89057] (3 PDB entries)

8. Domain d1mb8a2: 1mb8 A:181-293 [84926]

Details for d1mb8a2

PDB Entry: 1mb8, 2.15 Å

PDB Description: Crystal Structure of the actin binding domain of plectin

SCOP Domain Sequences for d1mb8a2:

Sequence; same for both SEQRES and ATOM records:

>d1mb8a2 a.40.1.1 (A:181-293) Actin binding domain of plectin {Human (Homo sapiens)}
qsedmtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpllidmnkvyrq
tnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamprvp

Timeline for d1mb8a2:

• d1mb8a2 first appeared in SCOP 1.65
  
• d1mb8a2 appears in SCOP 1.69
  
• d1mb8a2 appears in SCOP 1.73
  
• d1mb8a2 appears in the current release, SCOPe 2.08