SCOP 1.67: Domain d1m9yd_: 1m9y D:

Lineage for d1m9yd_ (1m9y D:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (4 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (11 PDB entries)

8. Domain d1m9yd_: 1m9y D: [84916]
   Other proteins in same PDB: d1m9ya_, d1m9yb_, d1m9ye_, d1m9yf_

Details for d1m9yd_

PDB Entry: 1m9y, 1.9 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,g89a complex.

SCOP Domain Sequences for d1m9yd_:

Sequence; same for both SEQRES and ATOM records:

>d1m9yd_ a.73.1.1 (D:) HIV-1 capsid protein {Human immunodeficiency virus type 1}
hqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlke
tineeaaewdrlhpvaaapiapgqmreprgsdiagttstlqeqigwmthnppipvgeiyk
rwiilglnkivrmys

Timeline for d1m9yd_:

• d1m9yd_ first appeared in SCOP 1.65
  
• d1m9yd_ appears in SCOP 1.69
  
• d1m9yd_ appears in the current release, SCOPe 2.08