Lineage for d1m9yb_ (1m9y B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1801476Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1801477Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1801478Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1801479Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 1801494Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (78 PDB entries)
    Uniprot P05092
  8. 1801535Domain d1m9yb_: 1m9y B: [84914]
    Other proteins in same PDB: d1m9yc_, d1m9yd_, d1m9yg_, d1m9yh_

Details for d1m9yb_

PDB Entry: 1m9y (more details), 1.9 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,g89a complex.
PDB Compounds: (B:) cyclophilin a

SCOPe Domain Sequences for d1m9yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9yb_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d1m9yb_:

Click to download the PDB-style file with coordinates for d1m9yb_.
(The format of our PDB-style files is described here.)

Timeline for d1m9yb_: