SCOPe 2.06: Domain d1m9yb_: 1m9y B:

Lineage for d1m9yb_ (1m9y B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (113 PDB entries)
   Uniprot P05092

8. Domain d1m9yb_: 1m9y B: [84914]
   Other proteins in same PDB: d1m9yc_, d1m9yd_, d1m9yg_, d1m9yh_

Details for d1m9yb_

PDB Entry: 1m9y, 1.9 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,g89a complex.

PDB Compounds: (B:) cyclophilin a

SCOPe Domain Sequences for d1m9yb_:

Sequence; same for both SEQRES and ATOM records:

>d1m9yb_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1m9yb_:

• d1m9yb_ first appeared in SCOP 1.65
  
• d1m9yb_ appears in SCOPe 2.05
  
• d1m9yb_ appears in SCOPe 2.07
  
• d1m9yb_ appears in the current release, SCOPe 2.08