| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) ![]() |
| Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (4 proteins) |
| Protein HIV-1 capsid protein [47945] (1 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (11 PDB entries) |
| Domain d1m9xh_: 1m9x H: [84912] Other proteins in same PDB: d1m9xa_, d1m9xb_, d1m9xe_, d1m9xf_ mutant |
PDB Entry: 1m9x (more details), 1.7 Å
SCOP Domain Sequences for d1m9xh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m9xh_ a.73.1.1 (H:) HIV-1 capsid protein {Human immunodeficiency virus type 1}
hqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlke
tineeaaewdrlhpvamapiapgqmreprgsdiagttstlqeqigwmthnppipvgeiyk
rwiilglnkivrmys
Timeline for d1m9xh_: