Lineage for d1m9xf_ (1m9x F:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674493Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 674494Superfamily b.62.1: Cyclophilin-like [50891] (3 families) (S)
  5. 674495Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 674496Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 674513Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (48 PDB entries)
  8. 674525Domain d1m9xf_: 1m9x F: [84910]
    Other proteins in same PDB: d1m9xc_, d1m9xd_, d1m9xg_, d1m9xh_
    mutant

Details for d1m9xf_

PDB Entry: 1m9x (more details), 1.7 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,a88m,g89a complex.
PDB Compounds: (F:) cyclophilin a

SCOP Domain Sequences for d1m9xf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9xf_ b.62.1.1 (F:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1m9xf_:

Click to download the PDB-style file with coordinates for d1m9xf_.
(The format of our PDB-style files is described here.)

Timeline for d1m9xf_: