Lineage for d1m9fb_ (1m9f B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959125Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 959126Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 959127Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
  6. 959128Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 959143Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (56 PDB entries)
    Uniprot P05092
  8. 959157Domain d1m9fb_: 1m9f B: [84899]
    Other proteins in same PDB: d1m9fc_, d1m9fd_

Details for d1m9fb_

PDB Entry: 1m9f (more details), 1.73 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,a88m complex.
PDB Compounds: (B:) cyclophilin a

SCOPe Domain Sequences for d1m9fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9fb_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d1m9fb_:

Click to download the PDB-style file with coordinates for d1m9fb_.
(The format of our PDB-style files is described here.)

Timeline for d1m9fb_: