Lineage for d1m9dd_ (1m9d D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495228Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1495229Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1495230Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1495269Protein HIV-1 capsid protein [47945] (1 species)
  7. 1495270Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (30 PDB entries)
  8. 1495295Domain d1m9dd_: 1m9d D: [84893]
    Other proteins in same PDB: d1m9da_, d1m9db_

Details for d1m9dd_

PDB Entry: 1m9d (more details), 1.9 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) o-type chimera complex.
PDB Compounds: (D:) hiv-1 capsid

SCOPe Domain Sequences for d1m9dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9dd_ a.73.1.1 (D:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrthppamgplppgqireprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

SCOPe Domain Coordinates for d1m9dd_:

Click to download the PDB-style file with coordinates for d1m9dd_.
(The format of our PDB-style files is described here.)

Timeline for d1m9dd_: