Lineage for d1m9dc_ (1m9d C:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 357657Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 357658Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 357659Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (4 proteins)
  6. 357665Protein HIV-1 capsid protein [47945] (1 species)
  7. 357666Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (11 PDB entries)
  8. 357675Domain d1m9dc_: 1m9d C: [84892]
    Other proteins in same PDB: d1m9da_, d1m9db_

Details for d1m9dc_

PDB Entry: 1m9d (more details), 1.9 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) o-type chimera complex.

SCOP Domain Sequences for d1m9dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9dc_ a.73.1.1 (C:) HIV-1 capsid protein {Human immunodeficiency virus type 1}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrthppamgplppgqireprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

SCOP Domain Coordinates for d1m9dc_:

Click to download the PDB-style file with coordinates for d1m9dc_.
(The format of our PDB-style files is described here.)

Timeline for d1m9dc_: