Lineage for d1m9db_ (1m9d B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1134137Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1134138Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1134139Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
  6. 1134140Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 1134155Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (57 PDB entries)
    Uniprot P05092
  8. 1134190Domain d1m9db_: 1m9d B: [84891]
    Other proteins in same PDB: d1m9dc_, d1m9dd_

Details for d1m9db_

PDB Entry: 1m9d (more details), 1.9 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) o-type chimera complex.
PDB Compounds: (B:) cyclophilin a

SCOPe Domain Sequences for d1m9db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9db_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
nptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfmc
qggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktewl
dgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d1m9db_:

Click to download the PDB-style file with coordinates for d1m9db_.
(The format of our PDB-style files is described here.)

Timeline for d1m9db_: