Lineage for d1m79a_ (1m79 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1004246Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1004247Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1004248Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1004391Protein Dihydrofolate reductases, eukaryotic type [53605] (6 species)
  7. 1004489Species Yeast (Candida albicans) [TaxId:5476] [53609] (12 PDB entries)
  8. 1004492Domain d1m79a_: 1m79 A: [84857]
    complexed with mes, mq1, ndp

Details for d1m79a_

PDB Entry: 1m79 (more details), 1.7 Å

PDB Description: candida albicans dihydrofolate reductase complexed with dihydro- nicotinamide-adenine-dinucleotide phosphate (nadph) and 5-(4- methoxyphenoxy)-2,4-quinazolinediamine (gw1466)
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1m79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m79a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk

SCOPe Domain Coordinates for d1m79a_:

Click to download the PDB-style file with coordinates for d1m79a_.
(The format of our PDB-style files is described here.)

Timeline for d1m79a_: