Lineage for d1m5qv_ (1m5q V:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948630Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 948631Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 948632Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 948824Protein Sm-Like archaeal protein Smap3 [89317] (1 species)
    contains additional C-terminal alpha+beta domain
  7. 948825Species Pyrobaculum aerophilum [TaxId:13773] [89318] (1 PDB entry)
  8. 948849Domain d1m5qv_: 1m5q V: [84831]
    complexed with acy, cd, gol, na

Details for d1m5qv_

PDB Entry: 1m5q (more details), 2 Å

PDB Description: crystal structure of a novel sm-like archaeal protein from pyrobaculum aerophilum
PDB Compounds: (V:) small nuclear ribonucleoprotein homolog

SCOPe Domain Sequences for d1m5qv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5qv_ b.38.1.1 (V:) Sm-Like archaeal protein Smap3 {Pyrobaculum aerophilum [TaxId: 13773]}
fvaelnnllgrevqvvlsngevykgvlhavdnqlnivlanasnkagekfnrvfimyryiv
hidsterridmrefakqaekifpgmvkyieetnvvligdkvrvseigvegvgpvaerakr
lfeeflkr

SCOPe Domain Coordinates for d1m5qv_:

Click to download the PDB-style file with coordinates for d1m5qv_.
(The format of our PDB-style files is described here.)

Timeline for d1m5qv_: