Lineage for d1m5qp_ (1m5q P:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1539176Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1539177Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1539178Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1539410Protein Sm-Like archaeal protein Smap3 [89317] (1 species)
    contains additional C-terminal alpha+beta domain
  7. 1539411Species Pyrobaculum aerophilum [TaxId:13773] [89318] (1 PDB entry)
  8. 1539429Domain d1m5qp_: 1m5q P: [84825]
    complexed with acy, cd, gol, na

Details for d1m5qp_

PDB Entry: 1m5q (more details), 2 Å

PDB Description: crystal structure of a novel sm-like archaeal protein from pyrobaculum aerophilum
PDB Compounds: (P:) small nuclear ribonucleoprotein homolog

SCOPe Domain Sequences for d1m5qp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5qp_ b.38.1.1 (P:) Sm-Like archaeal protein Smap3 {Pyrobaculum aerophilum [TaxId: 13773]}
fvaelnnllgrevqvvlsngevykgvlhavdnqlnivlanasnkagekfnrvfimyryiv
hidsterridmrefakqaekifpgmvkyieetnvvligdkvrvseigvegvgpvaerakr
lfeeflk

SCOPe Domain Coordinates for d1m5qp_:

Click to download the PDB-style file with coordinates for d1m5qp_.
(The format of our PDB-style files is described here.)

Timeline for d1m5qp_: