| Class b: All beta proteins [48724] (176 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
| Protein Sm-Like archaeal protein Smap3 [89317] (1 species) contains additional C-terminal alpha+beta domain |
| Species Pyrobaculum aerophilum [TaxId:13773] [89318] (1 PDB entry) |
| Domain d1m5qp_: 1m5q P: [84825] complexed with acy, cd, gol, na |
PDB Entry: 1m5q (more details), 2 Å
SCOPe Domain Sequences for d1m5qp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m5qp_ b.38.1.1 (P:) Sm-Like archaeal protein Smap3 {Pyrobaculum aerophilum [TaxId: 13773]}
fvaelnnllgrevqvvlsngevykgvlhavdnqlnivlanasnkagekfnrvfimyryiv
hidsterridmrefakqaekifpgmvkyieetnvvligdkvrvseigvegvgpvaerakr
lfeeflk
Timeline for d1m5qp_:
View in 3DDomains from other chains: (mouse over for more information) d1m5q1_, d1m5q2_, d1m5qa_, d1m5qb_, d1m5qc_, d1m5qd_, d1m5qe_, d1m5qf_, d1m5qg_, d1m5qh_, d1m5qi_, d1m5qj_, d1m5qk_, d1m5ql_, d1m5qm_, d1m5qn_, d1m5qo_, d1m5qq_, d1m5qr_, d1m5qs_, d1m5qt_, d1m5qu_, d1m5qv_, d1m5qw_, d1m5qx_, d1m5qy_, d1m5qz_ |