Lineage for d1m3ue_ (1m3u E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100061Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2100353Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (2 proteins)
    automatically mapped to Pfam PF02548
  6. 2100354Protein Ketopantoate hydroxymethyltransferase PanB [89504] (3 species)
    dodecameric enzyme; a C-terminal helix exchange is observed in the M. tuberculosis enzyme but not in the E. coli enzyme
  7. 2100355Species Escherichia coli [TaxId:562] [89506] (1 PDB entry)
  8. 2100360Domain d1m3ue_: 1m3u E: [84788]
    complexed with kpl, mg

Details for d1m3ue_

PDB Entry: 1m3u (more details), 1.8 Å

PDB Description: crystal structure of ketopantoate hydroxymethyltransferase complexed the product ketopantoate
PDB Compounds: (E:) 3-methyl-2-oxobutanoate hydroxymethyltransferase

SCOPe Domain Sequences for d1m3ue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3ue_ c.1.12.8 (E:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]}
pttisllqkykqekkrfatitaydysfaklfadeglnvmlvgdslgmtvqghdstlpvtv
adiayhtaavrrgapncllladlpfmayatpeqafenaatvmraganmvkieggewlvet
vqmlteravpvcghlgltpqsvnifggykvqgrgdeagdqllsdalaleaagaqllvlec
vpvelakritealaipvigigagnvtdgqilvmhdafgitgghipkfaknflaetgdira
avrqymaevesgvypgeehsfh

SCOPe Domain Coordinates for d1m3ue_:

Click to download the PDB-style file with coordinates for d1m3ue_.
(The format of our PDB-style files is described here.)

Timeline for d1m3ue_: