SCOP 1.67: Domain d1m35e1: 1m35 E:1-176

Lineage for d1m35e1 (1m35 E:1-176)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family)

5. Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)

6. Protein Aminopeptidase P [53096] (2 species)
   synonym: Xaa-Pro dipeptidase, prolidase

7. Species Escherichia coli [TaxId:562] [53097] (5 PDB entries)

8. Domain d1m35e1: 1m35 E:1-176 [84778]
   Other proteins in same PDB: d1m35a2, d1m35b2, d1m35c2, d1m35d2, d1m35e2, d1m35f2

Details for d1m35e1

PDB Entry: 1m35, 2.4 Å

PDB Description: Aminopeptidase P from Escherichia coli

SCOP Domain Sequences for d1m35e1:

Sequence; same for both SEQRES and ATOM records:

>d1m35e1 c.55.2.1 (E:1-176) Aminopeptidase P {Escherichia coli}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

Timeline for d1m35e1:

• d1m35e1 first appeared in SCOP 1.65
  
• d1m35e1 appears in SCOP 1.69
  
• d1m35e1 appears in the current release, SCOPe 2.08