Lineage for d1m35b1 (1m35 B:1-176)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397315Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 397603Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) (S)
  5. 397604Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)
  6. 397605Protein Aminopeptidase P [53096] (2 species)
    synonym: Xaa-Pro dipeptidase, prolidase
  7. 397609Species Escherichia coli [TaxId:562] [53097] (5 PDB entries)
  8. 397614Domain d1m35b1: 1m35 B:1-176 [84772]
    Other proteins in same PDB: d1m35a2, d1m35b2, d1m35c2, d1m35d2, d1m35e2, d1m35f2

Details for d1m35b1

PDB Entry: 1m35 (more details), 2.4 Å

PDB Description: Aminopeptidase P from Escherichia coli

SCOP Domain Sequences for d1m35b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m35b1 c.55.2.1 (B:1-176) Aminopeptidase P {Escherichia coli}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

SCOP Domain Coordinates for d1m35b1:

Click to download the PDB-style file with coordinates for d1m35b1.
(The format of our PDB-style files is described here.)

Timeline for d1m35b1: