Lineage for d1m35d2 (1m35 D:177-440)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974565Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 2974566Species Escherichia coli [TaxId:562] [55929] (20 PDB entries)
  8. 2974588Domain d1m35d2: 1m35 D:177-440 [84777]
    Other proteins in same PDB: d1m35a1, d1m35b1, d1m35c1, d1m35d1, d1m35e1, d1m35f1
    complexed with mn

Details for d1m35d2

PDB Entry: 1m35 (more details), 2.4 Å

PDB Description: Aminopeptidase P from Escherichia coli
PDB Compounds: (D:) aminopeptidase p

SCOPe Domain Sequences for d1m35d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m35d2 d.127.1.1 (D:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOPe Domain Coordinates for d1m35d2:

Click to download the PDB-style file with coordinates for d1m35d2.
(The format of our PDB-style files is described here.)

Timeline for d1m35d2: