Lineage for d1m35a1 (1m35 A:1-176)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2462791Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) (S)
  5. 2462792Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins)
  6. 2462793Protein Aminopeptidase P [53096] (2 species)
    synonym: Xaa-Pro dipeptidase, prolidase
  7. 2462794Species Escherichia coli [TaxId:562] [53097] (20 PDB entries)
  8. 2462821Domain d1m35a1: 1m35 A:1-176 [84770]
    Other proteins in same PDB: d1m35a2, d1m35b2, d1m35c2, d1m35d2, d1m35e2, d1m35f2
    complexed with mn

Details for d1m35a1

PDB Entry: 1m35 (more details), 2.4 Å

PDB Description: Aminopeptidase P from Escherichia coli
PDB Compounds: (A:) aminopeptidase p

SCOPe Domain Sequences for d1m35a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m35a1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

SCOPe Domain Coordinates for d1m35a1:

Click to download the PDB-style file with coordinates for d1m35a1.
(The format of our PDB-style files is described here.)

Timeline for d1m35a1: