Lineage for d1m2za_ (1m2z A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1280249Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1280250Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1280251Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1280513Protein Glucocorticoid receptor [89140] (1 species)
  7. 1280514Species Human (Homo sapiens) [TaxId:9606] [89141] (6 PDB entries)
  8. 1280521Domain d1m2za_: 1m2z A: [84768]
    complexed with coactivator peptide, chains B and E
    complexed with bog, dex

Details for d1m2za_

PDB Entry: 1m2z (more details), 2.5 Å

PDB Description: crystal structure of a dimer complex of the human glucocorticoid receptor ligand-binding domain bound to dexamethasone and a tif2 coactivator motif
PDB Compounds: (A:) Glucocorticoid receptor

SCOPe Domain Sequences for d1m2za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2za_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]}
atlpqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaip
gfrnlhlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpcmydq
ckhmlyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaiv
kregnssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqip
kysngnikkllfhqk

SCOPe Domain Coordinates for d1m2za_:

Click to download the PDB-style file with coordinates for d1m2za_.
(The format of our PDB-style files is described here.)

Timeline for d1m2za_: