SCOP 1.73: Domain d1lxnb_: 1lxn B:

Lineage for d1lxnb_ (1lxn B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.48: MTH1187/YkoF-like [89957] (2 families)

5. Family d.58.48.1: MTH1187-like [89958] (5 proteins)
   Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix

6. Protein Hypothetical protein MTH1187 [89959] (1 species)

7. Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [89960] (1 PDB entry)

8. Domain d1lxnb_: 1lxn B: [84738]

Details for d1lxnb_

PDB Entry: 1lxn, 2.3 Å

PDB Description: x-ray structure of mth1187 northeast structural genomics consortium target tt272

PDB Compounds: (B:) hypothetical protein mth1187

SCOP Domain Sequences for d1lxnb_:

Sequence; same for both SEQRES and ATOM records:

>d1lxnb_ d.58.48.1 (B:) Hypothetical protein MTH1187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
mitaeltviplgtcstslssyvaaavealkklnvryeisgmgtlleaedldelmeavkaa
heavlqagsdrvyttlkiddrrdadrglrdkvesvkeki

Timeline for d1lxnb_:

• d1lxnb_ first appeared in SCOP 1.65
  
• d1lxnb_ appears in SCOP 1.71
  
• d1lxnb_ appears in SCOP 1.75
  
• d1lxnb_ appears in the current release, SCOPe 2.08