Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.48: MTH1187-like [89957] (1 family) contains extra C-terminal helix |
Family d.58.48.1: MTH1187-like [89958] (2 proteins) PF01910, unknown function |
Protein Hypothetical protein MTH1187 [89959] (1 species) |
Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [89960] (1 PDB entry) |
Domain d1lxnb_: 1lxn B: [84738] |
PDB Entry: 1lxn (more details), 2.3 Å
SCOP Domain Sequences for d1lxnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lxnb_ d.58.48.1 (B:) Hypothetical protein MTH1187 {Archaeon Methanobacterium thermoautotrophicum} mitaeltviplgtcstslssyvaaavealkklnvryeisgmgtlleaedldelmeavkaa heavlqagsdrvyttlkiddrrdadrglrdkvesvkeki
Timeline for d1lxnb_: