Lineage for d1lxna_ (1lxn A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 330116Superfamily d.58.48: MTH1187-like [89957] (1 family) (S)
    contains extra C-terminal helix
  5. 330117Family d.58.48.1: MTH1187-like [89958] (2 proteins)
    PF01910, unknown function
  6. 330118Protein Hypothetical protein MTH1187 [89959] (1 species)
  7. 330119Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [89960] (1 PDB entry)
  8. 330120Domain d1lxna_: 1lxn A: [84737]

Details for d1lxna_

PDB Entry: 1lxn (more details), 2.3 Å

PDB Description: x-ray structure of mth1187 northeast structural genomics consortium target tt272

SCOP Domain Sequences for d1lxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxna_ d.58.48.1 (A:) Hypothetical protein MTH1187 {Archaeon Methanobacterium thermoautotrophicum}
mitaeltviplgtcstslssyvaaavealkklnvryeisgmgtlleaedldelmeavkaa
heavlqagsdrvyttlkiddrrdadrglrdkvesvkeki

SCOP Domain Coordinates for d1lxna_:

Click to download the PDB-style file with coordinates for d1lxna_.
(The format of our PDB-style files is described here.)

Timeline for d1lxna_: