Class g: Small proteins [56992] (85 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (3 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins) |
Protein Type II activin receptor [57357] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [57358] (3 PDB entries) |
Domain d1lx5b_: 1lx5 B: [84733] Other proteins in same PDB: d1lx5a_ complexed with BMP7 complexed with man, nag |
PDB Entry: 1lx5 (more details), 3.3 Å
SCOP Domain Sequences for d1lx5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lx5b_ g.7.1.3 (B:) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]} etqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddinc ydrtdciekkdspevyfcccegnmcnekfsyfpe
Timeline for d1lx5b_: