SCOP 1.73: Domain d1lx5b_: 1lx5 B:

Lineage for d1lx5b_ (1lx5 B:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (3 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins)

6. Protein Type II activin receptor [57357] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57358] (3 PDB entries)

8. Domain d1lx5b_: 1lx5 B: [84733]
   Other proteins in same PDB: d1lx5a_
   complexed with BMP7
   complexed with man, nag

Details for d1lx5b_

PDB Entry: 1lx5, 3.3 Å

PDB Description: crystal structure of the bmp7/actrii extracellular domain complex

PDB Compounds: (B:) Activin Type II Receptor

SCOP Domain Sequences for d1lx5b_:

Sequence; same for both SEQRES and ATOM records:

>d1lx5b_ g.7.1.3 (B:) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]}
etqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddinc
ydrtdciekkdspevyfcccegnmcnekfsyfpe

Timeline for d1lx5b_:

• d1lx5b_ first appeared in SCOP 1.65
  
• d1lx5b_ appears in SCOP 1.71
  
• d1lx5b_ appears in SCOP 1.75
  
• d1lx5b_ appears in the current release, SCOPe 2.08