Lineage for d1lx5b_ (1lx5 B:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890226Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 890227Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 890414Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 890445Protein Type II activin receptor [57357] (3 species)
  7. 890446Species Mouse (Mus musculus) [TaxId:10090] [57358] (3 PDB entries)
  8. 890451Domain d1lx5b_: 1lx5 B: [84733]
    Other proteins in same PDB: d1lx5a_
    complexed with BMP7
    complexed with man, nag

Details for d1lx5b_

PDB Entry: 1lx5 (more details), 3.3 Å

PDB Description: crystal structure of the bmp7/actrii extracellular domain complex
PDB Compounds: (B:) Activin Type II Receptor

SCOP Domain Sequences for d1lx5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lx5b_ g.7.1.3 (B:) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]}
etqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddinc
ydrtdciekkdspevyfcccegnmcnekfsyfpe

SCOP Domain Coordinates for d1lx5b_:

Click to download the PDB-style file with coordinates for d1lx5b_.
(The format of our PDB-style files is described here.)

Timeline for d1lx5b_: