Lineage for d1ltoc_ (1lto C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2064537Protein Alpha tryptase I [89341] (1 species)
  7. 2064538Species Human (Homo sapiens) [TaxId:9606] [89342] (1 PDB entry)
  8. 2064541Domain d1ltoc_: 1lto C: [84709]

Details for d1ltoc_

PDB Entry: 1lto (more details), 2.2 Å

PDB Description: Human alpha1-tryptase
PDB Compounds: (C:) alpha tryptase I

SCOPe Domain Sequences for d1ltoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltoc_ b.47.1.2 (C:) Alpha tryptase I {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahclgpdvkdlatlrvql
reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
cagnsqrdsckgdsggplvckvngtwlqagvvswdegcaqpnrpgiytrvtyyldwihhy
vpk

SCOPe Domain Coordinates for d1ltoc_:

Click to download the PDB-style file with coordinates for d1ltoc_.
(The format of our PDB-style files is described here.)

Timeline for d1ltoc_: