Lineage for d1ltkc_ (1ltk C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1622941Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 1622942Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 1622943Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 1622944Protein Phosphoglycerate kinase [53750] (8 species)
  7. 1622953Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [89783] (3 PDB entries)
  8. 1622961Domain d1ltkc_: 1ltk C: [84700]
    complexed with amp, gol, so4

Details for d1ltkc_

PDB Entry: 1ltk (more details), 3 Å

PDB Description: crystal structure of phosphoglycerate kinase from plasmodium falciparum, in the open conformation
PDB Compounds: (C:) phosphoglycerate kinase

SCOPe Domain Sequences for d1ltkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltkc_ c.86.1.1 (C:) Phosphoglycerate kinase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
hsmhhhhhhlgnklsisdlkdiknkkvlvrvdfnvpiengiikdtnritatlptinhlkk
egaskiilishcgrpdglrnekytlkpvaetlkgllgeevlflndcvgkevedkinaake
nsvillenlrfhieeegkgvdangnkvkankedvekfqndltkladvfindafgtahrah
ssmvgvklnvkasgflmkkeleyfskalenpqrpllailggakvsdkiqliknlldkvdr
miigggmaytfkkvlnnmkigtslfdeagskivgeimekakaknvqiflpvdfkiadnfd
nnantkfvtdeegipdnwmgldagpksienykdviltsktviwngpqgvfempnfakgsi
eclnlvvevtkkgaitivgggdtaslveqqnkkneishvstgggaslellegkelpgvla
lsnk

SCOPe Domain Coordinates for d1ltkc_:

Click to download the PDB-style file with coordinates for d1ltkc_.
(The format of our PDB-style files is described here.)

Timeline for d1ltkc_: