Lineage for d1lr7a2 (1lr7 A:89-136)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 2589436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 2589437Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 2589463Protein Domain of follistatin [90166] (1 species)
    the C-terminal part of the heparin-binding module, FS1
  7. 2589464Species Norway rat (Rattus norvegicus) [TaxId:10116] [90167] (3 PDB entries)
  8. 2589465Domain d1lr7a2: 1lr7 A:89-136 [84680]
    Other proteins in same PDB: d1lr7a1
    complexed with so4

Details for d1lr7a2

PDB Entry: 1lr7 (more details), 1.5 Å

PDB Description: Crystal structure of Fs1, the heparin-binding domain of follistatin, complexed with the heparin analogue sucrose octasulphate (SOS)
PDB Compounds: (A:) Follistatin

SCOPe Domain Sequences for d1lr7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
capdcsnitwkgpvcgldgktyrnecallkarckeqpelevqyqgkck

SCOPe Domain Coordinates for d1lr7a2:

Click to download the PDB-style file with coordinates for d1lr7a2.
(The format of our PDB-style files is described here.)

Timeline for d1lr7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lr7a1