Lineage for d1lojl_ (1loj L:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123076Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1123077Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1123078Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1123079Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 1123125Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 1123151Domain d1lojl_: 1loj L: [84661]
    complexed with mpd, u, uri

Details for d1lojl_

PDB Entry: 1loj (more details), 1.9 Å

PDB Description: Crystal structure of a Methanobacterial Sm-like archaeal protein (SmAP1) bound to uridine-5'-monophosphate (UMP)
PDB Compounds: (L:) small nuclear ribonucleoprotein homolog (Sm-like)

SCOPe Domain Sequences for d1lojl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lojl_ b.38.1.1 (L:) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
nvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtv
lirgdnivyisrgk

SCOPe Domain Coordinates for d1lojl_:

Click to download the PDB-style file with coordinates for d1lojl_.
(The format of our PDB-style files is described here.)

Timeline for d1lojl_: