Class b: All beta proteins [48724] (176 folds) |
Fold b.112: C-terminal domain of mollusc hemocyanin [81278] (1 superfamily) six-stranded beta-sandwich, jelly-roll/greek-key topology |
Superfamily b.112.1: C-terminal domain of mollusc hemocyanin [81277] (1 family) analogous to the Ig-like domain of arthropod hemocyanin; similar sequential but different spatial position relative the shared domain |
Family b.112.1.1: C-terminal domain of mollusc hemocyanin [81276] (1 protein) |
Protein C-terminal domain of mollusc hemocyanin [69165] (2 species) |
Species Mollusca (Rapana thomasiana) [TaxId:29165] [89218] (1 PDB entry) |
Domain d1lnlc2: 1lnl C:305-405 [84640] Other proteins in same PDB: d1lnla1, d1lnlb1, d1lnlc1 complexed with cu, nag |
PDB Entry: 1lnl (more details), 3.3 Å
SCOPe Domain Sequences for d1lnlc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnlc2 b.112.1.1 (C:305-405) C-terminal domain of mollusc hemocyanin {Mollusca (Rapana thomasiana) [TaxId: 29165]} adrvfagfllegigtsahldfsicaidgecthagyfdvlggsletpwqfdrlykyeitdv leskgldvhdvfdikitqtswdnedistdrfpppsviyvpk
Timeline for d1lnlc2:
View in 3D Domains from other chains: (mouse over for more information) d1lnla1, d1lnla2, d1lnlb1, d1lnlb2 |