SCOPe 2.05: Domain d1lnlc2: 1lnl C:305-405

Lineage for d1lnlc2 (1lnl C:305-405)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.112: C-terminal domain of mollusc hemocyanin [81278] (1 superfamily)
   six-stranded beta-sandwich, jelly-roll/greek-key topology

4. Superfamily b.112.1: C-terminal domain of mollusc hemocyanin [81277] (1 family)
   analogous to the Ig-like domain of arthropod hemocyanin; similar sequential but different spatial position relative the shared domain

5. Family b.112.1.1: C-terminal domain of mollusc hemocyanin [81276] (1 protein)

6. Protein C-terminal domain of mollusc hemocyanin [69165] (2 species)

7. Species Mollusca (Rapana thomasiana) [TaxId:29165] [89218] (1 PDB entry)

8. Domain d1lnlc2: 1lnl C:305-405 [84640]
   Other proteins in same PDB: d1lnla1, d1lnlb1, d1lnlc1
   complexed with cu, nag

Details for d1lnlc2

PDB Entry: 1lnl, 3.3 Å

PDB Description: structure of deoxygenated hemocyanin from rapana thomasiana

PDB Compounds: (C:) Hemocyanin

SCOPe Domain Sequences for d1lnlc2:

Sequence; same for both SEQRES and ATOM records:

>d1lnlc2 b.112.1.1 (C:305-405) C-terminal domain of mollusc hemocyanin {Mollusca (Rapana thomasiana) [TaxId: 29165]}
adrvfagfllegigtsahldfsicaidgecthagyfdvlggsletpwqfdrlykyeitdv
leskgldvhdvfdikitqtswdnedistdrfpppsviyvpk

Timeline for d1lnlc2:

• d1lnlc2 first appeared in SCOP 1.65
  
• d1lnlc2 appears in SCOPe 2.04
  
• d1lnlc2 appears in SCOPe 2.06
  
• d1lnlc2 appears in the current release, SCOPe 2.08