Lineage for d1lnlc2 (1lnl C:305-405)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821177Fold b.112: C-terminal domain of mollusc hemocyanin [81278] (1 superfamily)
    six-stranded beta-sandwich, jelly-roll/greek-key topology
  4. 2821178Superfamily b.112.1: C-terminal domain of mollusc hemocyanin [81277] (1 family) (S)
    analogous to the Ig-like domain of arthropod hemocyanin; similar sequential but different spatial position relative the shared domain
  5. 2821179Family b.112.1.1: C-terminal domain of mollusc hemocyanin [81276] (1 protein)
  6. 2821180Protein C-terminal domain of mollusc hemocyanin [69165] (2 species)
  7. 2821184Species Mollusca (Rapana thomasiana) [TaxId:29165] [89218] (1 PDB entry)
  8. 2821187Domain d1lnlc2: 1lnl C:305-405 [84640]
    Other proteins in same PDB: d1lnla1, d1lnlb1, d1lnlc1
    complexed with cu, nag

Details for d1lnlc2

PDB Entry: 1lnl (more details), 3.3 Å

PDB Description: structure of deoxygenated hemocyanin from rapana thomasiana
PDB Compounds: (C:) Hemocyanin

SCOPe Domain Sequences for d1lnlc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnlc2 b.112.1.1 (C:305-405) C-terminal domain of mollusc hemocyanin {Mollusca (Rapana thomasiana) [TaxId: 29165]}
adrvfagfllegigtsahldfsicaidgecthagyfdvlggsletpwqfdrlykyeitdv
leskgldvhdvfdikitqtswdnedistdrfpppsviyvpk

SCOPe Domain Coordinates for d1lnlc2:

Click to download the PDB-style file with coordinates for d1lnlc2.
(The format of our PDB-style files is described here.)

Timeline for d1lnlc2: