Lineage for d1lgva1 (1lgv A:1-112)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105202Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1105237Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)
  8. 1105238Domain d1lgva1: 1lgv A:1-112 [84608]
    Other proteins in same PDB: d1lgva2, d1lgvb2
    part of amyloidogenic protein BUR

Details for d1lgva1

PDB Entry: 1lgv (more details), 1.95 Å

PDB Description: structure of a human bence-jones dimer crystallized in u.s. space shuttle mission sts-95: 100k
PDB Compounds: (A:) immunoglobulin lambda light chain

SCOPe Domain Sequences for d1lgva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlg

SCOPe Domain Coordinates for d1lgva1:

Click to download the PDB-style file with coordinates for d1lgva1.
(The format of our PDB-style files is described here.)

Timeline for d1lgva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lgva2