Lineage for d1l9wc_ (1l9w C:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 817252Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 817253Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 817694Protein Type I 3-dehydroquinate dehydratase [51586] (2 species)
  7. 817695Species Salmonella typhi [TaxId:90370] [51587] (3 PDB entries)
  8. 817701Domain d1l9wc_: 1l9w C: [84572]

Details for d1l9wc_

PDB Entry: 1l9w (more details), 2.1 Å

PDB Description: crystal structure of 3-dehydroquinase from salmonella typhi complexed with reaction product
PDB Compounds: (C:) 3-dehydroquinate dehydratase aroD

SCOP Domain Sequences for d1l9wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9wc_ c.1.10.1 (C:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]}
mktvtvknliigegmpkiivslmgrdinsvkaealayreatfdilewrvdhfmdiastqs
vltaarvirdampdipllftfrsakeggeqtittqhyltlnraaidsglvdmidlelftg
dadvkatvdyahahnvyvvmsnhdfhqtpsaeemvsrlrkmqalgadipkiavmpqskhd
vltlltatlemqqhyadrpvitmsmakegvisrlagevfgsaatfgavkqasapgqiavn
dlrsvlmilhna

SCOP Domain Coordinates for d1l9wc_:

Click to download the PDB-style file with coordinates for d1l9wc_.
(The format of our PDB-style files is described here.)

Timeline for d1l9wc_: