Lineage for d1l8he_ (1l8h E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314869Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2314920Species Escherichia coli, Dps [TaxId:562] [47251] (8 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 2315021Domain d1l8he_: 1l8h E: [84542]
    protein/DNA complex; complexed with k, trs

Details for d1l8he_

PDB Entry: 1l8h (more details), 3.2 Å

PDB Description: dna protection and binding by e. coli dps protein
PDB Compounds: (E:) DNA protection during starvation protein

SCOPe Domain Sequences for d1l8he_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8he_ a.25.1.1 (E:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
vrkaigeakdddtadiltaasrdldkflwfiesnie

SCOPe Domain Coordinates for d1l8he_:

Click to download the PDB-style file with coordinates for d1l8he_.
(The format of our PDB-style files is described here.)

Timeline for d1l8he_: