| Class b: All beta proteins [48724] (165 folds) |
| Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (4 families) ![]() peptide-binding domain |
| Family b.36.1.1: PDZ domain [50157] (46 proteins) Pfam PF00595 |
| Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (2 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [89314] (2 PDB entries) |
| Domain d1l6oc_: 1l6o C: [84536] complexed with a peptide from Daper 1, chains D, E and F complexed with mse |
PDB Entry: 1l6o (more details), 2.2 Å
SCOP Domain Sequences for d1l6oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6oc_ b.36.1.1 (C:) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
nfenmsnddavrvlrdivhkpgpivltvakle
Timeline for d1l6oc_: