Lineage for d1l6oc_ (1l6o C:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666744Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (2 species)
  7. 666745Species African clawed frog (Xenopus laevis) [TaxId:8355] [89314] (2 PDB entries)
  8. 666752Domain d1l6oc_: 1l6o C: [84536]
    complexed with a peptide from Daper 1, chains D, E and F
    complexed with mse

Details for d1l6oc_

PDB Entry: 1l6o (more details), 2.2 Å

PDB Description: xenopus dishevelled pdz domain
PDB Compounds: (C:) Segment polarity protein dishevelled homolog DVL-2

SCOP Domain Sequences for d1l6oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6oc_ b.36.1.1 (C:) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
nfenmsnddavrvlrdivhkpgpivltvakle

SCOP Domain Coordinates for d1l6oc_:

Click to download the PDB-style file with coordinates for d1l6oc_.
(The format of our PDB-style files is described here.)

Timeline for d1l6oc_: